X
Email:
sales@ruixibiotech.com

GHRF Peptide (Rat),Cas:86472-71-1

growth hormone-releasing factor Peptide (Rat)

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1351 1mg 500.00
- +
+ Add to cart

Product description

The growth hormone-releasing factor (GHRF) is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 86472-71-1
Synonyms Somatoliberin; growth hormone-releasing factor; GRF; growth hormone-releasing hormone; GHRH; somatocrinin; somatorelin; sermorelin
Sequence H-His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Arg-Ser-Arg-Phe-Asn-OH or H-HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN-OH
Molecular Formula  C225H361N77O66S
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product