GHRF Peptide (Rat),Cas:86472-71-1
growth hormone-releasing factor Peptide (Rat)
Product description
The growth hormone-releasing factor (GHRF) is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 86472-71-1 |
Synonyms | Somatoliberin; growth hormone-releasing factor; GRF; growth hormone-releasing hormone; GHRH; somatocrinin; somatorelin; sermorelin |
Sequence | H-His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Arg-Ser-Arg-Phe-Asn-OH or H-HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN-OH |
Molecular Formula | C225H361N77O66S |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product